DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7231 and FAM151B

DIOPT Version :9

Sequence 1:NP_723327.1 Gene:CG7231 / 34086 FlyBaseID:FBgn0031968 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_011541536.1 Gene:FAM151B / 167555 HGNCID:33716 Length:292 Species:Homo sapiens


Alignment Length:273 Identity:95/273 - (34%)
Similarity:136/273 - (49%) Gaps:29/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IEYIFLKQSDMMKVWGTNLTAITWAHAVNSQQLLDEVLTETSGIDFIEADIVLGKLNGDGEDMPI 110
            :|| ||:.|.:....|..   |||.||.|.:...:|.|..|:  ..||||::|.. :|.....||
Human    32 LEY-FLRNSQITAEDGAE---ITWYHAANHKAQTNEALKSTA--HMIEADVLLPS-DGSEHSQPI 89

  Fly   111 MAHPPANVSDLTLSEFLNQIINFNRDHEDQKKGVKLDFKSIEVFEGSLDILDVNIPNVSLPTTYP 175
            |||||...||.||.|:|.:::..|       ||:||||||:.|.|.|:.:|:    ||......|
Human    90 MAHPPETNSDNTLQEWLTEVMKSN-------KGIKLDFKSLAVVEPSMMLLE----NVKRHLKRP 143

  Fly   176 VWINADILSGPVEQNRTVPVDADRFFAGCMR-YKQAVLSIGWTTNWGADFRDGEYTQQQCDDMLE 239
            ||||||||.||...::.  :||..|....:. :.....|:||||.|..:..:..|:.....:|..
Human   144 VWINADILPGPNGNSKV--IDAKPFLDTVISFFPDVTFSLGWTTGWHPEKVNEGYSWTMVKEMEY 206

  Fly   240 TLSENNVLSTGQAITFPVRAGIAANSEEQLHRLVAAVNETNESTLTIWSSAGDYVDVDKLRKLIF 304
            ..:|     ..|.:||||||.:...|..||..|   :.::|..:||||:...|...|:.|..:..
Human   207 ICNE-----LSQPVTFPVRAALVRQSCSQLLWL---LKKSNRYSLTIWTGKNDNYSVEDLLYIRD 263

  Fly   305 SFGLDRVYLDVPE 317
            .|...:|:.|:.|
Human   264 HFDKKQVFYDILE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7231NP_723327.1 DUF2181 63..319 CDD:287226 89/256 (35%)
FAM151BXP_011541536.1 DUF2181 45..279 CDD:287226 90/259 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145089
Domainoid 1 1.000 127 1.000 Domainoid score I5374
eggNOG 1 0.900 - - E1_KOG3748
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17853
Inparanoid 1 1.050 127 1.000 Inparanoid score I4687
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49641
OrthoDB 1 1.010 - - D1117332at2759
OrthoFinder 1 1.000 - - FOG0003384
OrthoInspector 1 1.000 - - otm41130
orthoMCL 1 0.900 - - OOG6_106740
Panther 1 1.100 - - LDO PTHR21184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3564
SonicParanoid 1 1.000 - - X5597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.