DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7231 and fam151b

DIOPT Version :9

Sequence 1:NP_723327.1 Gene:CG7231 / 34086 FlyBaseID:FBgn0031968 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_002934860.1 Gene:fam151b / 100487835 XenbaseID:XB-GENE-5954319 Length:294 Species:Xenopus tropicalis


Alignment Length:278 Identity:103/278 - (37%)
Similarity:145/278 - (52%) Gaps:35/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DDSQIEYIFLKQSDMMKVWGTNLTAITWAHAVNSQQLLDEVLTETSGIDFIEADIVLGKLNGDGE 106
            |::.::|:..|  |::|  ..:...:.|.|||||:..|:|.:  .|....||||::   |.||.|
 Frog    35 DENILDYLLKK--DLIK--NRDGAEVIWCHAVNSKSKLNEAI--QSDAHMIEADVL---LRGDNE 90

  Fly   107 DMPIMAHPPANVSDLTLSEFLNQIINFNRDHEDQKKGVKLDFKSIEVFEGSLDILDVNIPNVSLP 171
              |||||||...||:||.|:|:|:.:       .:||:|||||.||....||.||..    :...
 Frog    91 --PIMAHPPETDSDITLHEWLDQVFS-------SEKGIKLDFKCIEAVLPSLQILAA----MKAT 142

  Fly   172 TTYPVWINADILSGPVEQNRTVPVDADRFFAGCMRY-KQAVLSIGWTTNWGADFRDGEYTQQQCD 235
            ...|:||||||||||  ..:...|||..|....|.| ....||:||||.|.....:..|:.:...
 Frog   143 VKQPIWINADILSGP--GGKAKAVDAKEFINSVMSYFPDVTLSLGWTTGWHPGQENQGYSWEMVQ 205

  Fly   236 DMLETLSENNVLSTGQAITFPVRAGIAANSEEQLHRLVAAVNETNES-TLTIWSSAGDYVDVDKL 299
            || |.:.:  |||  |.:||||||.:...|..|...|:    :|:|. :||:|:...|...|:.|
 Frog   206 DM-EKICK--VLS--QPVTFPVRAALLRQSWPQFQWLL----KTSERFSLTVWAGKDDTYPVEDL 261

  Fly   300 RKLIFSFGLDRVYLDVPE 317
            ..:..:....|:|.||.|
 Frog   262 LFIRDNSEKCRIYYDVFE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7231NP_723327.1 DUF2181 63..319 CDD:287226 98/257 (38%)
fam151bXP_002934860.1 DUF2181 52..282 CDD:370895 98/257 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5147
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H17853
Inparanoid 1 1.050 132 1.000 Inparanoid score I4495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1117332at2759
OrthoFinder 1 1.000 - - FOG0003384
OrthoInspector 1 1.000 - - otm48336
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3564
SonicParanoid 1 1.000 - - X5597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.