DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7231 and fam151a

DIOPT Version :9

Sequence 1:NP_723327.1 Gene:CG7231 / 34086 FlyBaseID:FBgn0031968 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001093565.1 Gene:fam151a / 100005645 ZFINID:ZDB-GENE-070705-105 Length:599 Species:Danio rerio


Alignment Length:330 Identity:99/330 - (30%)
Similarity:155/330 - (46%) Gaps:55/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTTLLFVLVAKINGSALNASNYQYQVVVEQTAPDDSQIEYIF----LKQSDMMKVWGTNLTAIT 68
            |:..||.:.:..:  ..:..|:....|.:|....|...::::.    :::.|.:..        |
Zfish    43 LIALLLIITLTSV--FVIAKSDASVDVDMEPFPSDGDMLDFLLQTGEIEEKDGLYA--------T 97

  Fly    69 WAHAVNSQQLLDEVLTETSGIDFIEADI-VLGKLNGDGEDMPIMAHPPANVSDLTLSEFLNQIIN 132
            |.||.||:..:.:.|  .|.:..:|||: |.|....:..::|||||||...||.||.|:|:.::.
Zfish    98 WYHAANSKSEMSKAL--NSDVMILEADVNVQGHNTVNETNIPIMAHPPDIYSDNTLEEWLDAVLK 160

  Fly   133 FNRDHEDQKKGVKLDFKSIEVFEGSLDILDV-NIPNVSLPTTYPVWINADILSGPVEQNRTVP-- 194
                   .|||||||||||...|.|||:|.. |...::    .|||||||||.||     .||  
Zfish   161 -------SKKGVKLDFKSISAVEPSLDLLRAKNQTGIN----RPVWINADILPGP-----NVPEF 209

  Fly   195 ---VDADRFFAGC-MRYKQAVLSIGWTTNWGADFRDGEYTQQQCDDMLETLSENNVLSTGQAITF 255
               |:|..||... :::....:|.||...:.:.|.:..||:...:.|..|:..     ..|.|||
Zfish   210 WPVVNASEFFELIQLKFPDVTISPGWKVLYLSIFPNVTYTRSMVEQMYSTIRH-----LPQKITF 269

  Fly   256 PVRAGIAANSEEQLHRLVAAVNETNESTLTIWSSAGDYVDVDKLRKLIF---SFGLDRVYLDVPE 317
            ||.|.:|.|....|..|   :::::..:||:|...    :...|..|:|   :....|:|.|:.|
Zfish   270 PVHALMAKNGWPHLSWL---LSQSSRYSLTLWQGK----ENPTLNDLLFIRDNSNPQRIYYDIYE 327

  Fly   318 ELASQ 322
            .:.||
Zfish   328 PVLSQ 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7231NP_723327.1 DUF2181 63..319 CDD:287226 89/266 (33%)
fam151aNP_001093565.1 DUF2181 92..330 CDD:287226 90/275 (33%)
DUF2181 362..589 CDD:287226
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578399
Domainoid 1 1.000 125 1.000 Domainoid score I5421
eggNOG 1 0.900 - - E1_KOG3748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1117332at2759
OrthoFinder 1 1.000 - - FOG0003384
OrthoInspector 1 1.000 - - otm25619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21184
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.