DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb6c

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:365 Identity:110/365 - (30%)
Similarity:191/365 - (52%) Gaps:23/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNL----PEDKKNVATIYDKLLTKLER 86
            |.:::..|:..||:.:...:.|:|:||.|.||.::..||:|    ..:..:|...:..||:::.:
Mouse    20 LGEDRSKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSEDGDVHQGFQLLLSEVNK 84

  Fly    87 GKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL-KAAWAINDWVLDQTLDNV 150
            ......|..|||||..:|..:...:....:|.:.||.|.:...... ::...||.||..:|.|.:
Mouse    85 TGTQYSLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELDFKGATEQSRQHINTWVAKKTEDKI 149

  Fly   151 KDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKM--- 212
            |:::.|..:..:...:::||.:|||.|:.:|:|.:|:...|.|||:.:..|.||.|...|||   
Mouse   150 KELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFKVSKNEEKPVQMMFQKSTFKMTYV 214

  Fly   213 -RTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLTEMD------VHVQLPKF 270
             ..||  :|:.||:..:.|:|:|:||.::..|:..|..|.....|..|.:|      |.|.||.|
Mouse   215 EEIST--KILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKFIEWTRLDRMKGEKVEVFLPWF 277

  Fly   271 KIDFRMELVETLKSMGIQDLFNSS-SDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPI 334
            |::...::.:.|..:|:.|.|... :|.|.:.::.|..:|.|:||:.:|::|||..|.:|:...:
Mouse   278 KLEENYDMKDVLCKLGMTDAFEEGRADFSGISSKQGLFLSNVIHKSVVEVNEEGSEATAATTIVL 342

  Fly   335 RGLSDYATSVVTFTVNSPFVFMIR--DDDNIYFRGRVVDP 372
            :|.|   .|...|.||.||:|.|:  ..:.|.|.||:..|
Mouse   343 KGSS---RSTPCFCVNRPFIFFIQHIKTNEILFLGRLSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 108/360 (30%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 109/363 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.