DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb9g

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_035585.2 Gene:Serpinb9g / 93806 MGIID:1919260 Length:377 Species:Mus musculus


Alignment Length:379 Identity:108/379 - (28%)
Similarity:184/379 - (48%) Gaps:31/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDK 79
            |.|...|.:...|||...|:..||:.:...::|:|:||.|:||.::..||:|..| ::|...:..
Mouse     9 GTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPD-EDVHQGFQL 72

  Fly    80 LLTKL-ERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL-KAAWAINDWV 142
            ||..| ::..:...|.:||||||..|..:...:.:...|.:.:|.|.:..|:.. ::...||.||
Mouse    73 LLHNLNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWV 137

  Fly   143 LDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQV 207
            ..||...:.|::....:......::.||.:|.|.|..||:|..||...|.::|.....|.||   
Mouse   138 SKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMM--- 199

  Fly   208 GRFKMRTSTI---------DQIIELPFAYSNLSMVIVLP-------KDNGSLTQAEATIESYPQI 256
                .|..|:         .|::.:|:...:|:.|::||       |...:||..:.|..:.|:.
Mouse   200 ----WREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEF 260

  Fly   257 VLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAFIEID 320
             :...:.||.||||::....::...|:.:||.::|: |.:|:|.:..:....:|:..||..:|::
Mouse   261 -MNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFAHKCVVEVN 324

  Fly   321 EEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDP 372
            |||..|.:|||.....|.. .....||..:.||:|.|  |..::|.|.||...|
Mouse   325 EEGTEAAAASAVKFIFLCS-GPDPETFCADHPFLFFIMHRTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 105/373 (28%)
Serpinb9gNP_035585.2 SERPIN 4..377 CDD:294093 107/377 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.