DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINH1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:363 Identity:85/363 - (23%)
Similarity:172/363 - (47%) Gaps:18/363 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE--DKKNVATIYDKLLTK 83
            ||::..:|....||:.||:.|...:.::.:|....||::.:..|:..:  |::..|.:.:.|.:.
Human    54 LYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSL 118

  Fly    84 LERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLD 148
            .....:.....|.:||:...::.....:.:...:|:..|...|...|:..|..:||:|....|..
Human   119 SNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDG 183

  Fly   149 NVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMR 213
            .:.:  :..|:...:.|:::||.|||.:|..:|.......:.|.|::||.|.|.||.:.|.:...
Human   184 KLPE--VTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNYY 246

  Fly   214 TSTID--QIIELPFAYSNLSMVIVLPKDNGSLTQAEATI-ESYPQIVLTEMD---VHVQLPKFKI 272
            ....:  ||:|:|.|:...|::|::|.....|.:.|..: :...:|.:.:|.   |.:.|||..:
Human   247 DDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVV 311

  Fly   273 DFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRG 336
            :...:|.:.|..:|:.:..: :.:|:|.:..:....::.|.|....|:|.:    |:.....|.|
Human   312 EVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTD----GNPFDQDIYG 372

  Fly   337 LSDYATSVVTFTVNSPFVFMIRD--DDNIYFRGRVVDP 372
            ..: ..|...|..:.||:|::||  ..::.|.||:|.|
Human   373 REE-LRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 82/358 (23%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 85/363 (23%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.