DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA6

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:390 Identity:103/390 - (26%)
Similarity:188/390 - (48%) Gaps:63/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPEDK--------K 71
            |...||:..:..:.:.||..||:.:.:.::|:.:|..|:|..:|...|  ||.|..        :
Human    46 FAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQ 110

  Fly    72 NVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAW 136
            ::..::.|..|.||       :.:.|.||::.::.:.:.::..:..::.:|..|:...|...|:.
Human   111 HLHQLFAKSDTSLE-------MTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASR 168

  Fly   137 AINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNV 201
            .||.:|.::|...:.|:.  |.|......|::|..||||.|...||..:|:.:.|||.::..|.|
Human   169 QINSYVKNKTQGKIVDLF--SGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKV 231

  Fly   202 NMMSQVGRFKMRTSTID---------QIIELPFAYSNLSMVIVLPKDNGSLTQAEA-----TIES 252
            .||       :::|||.         |::::.:. .|.::..:|| |.|.:....|     ||..
Human   232 PMM-------LQSSTISYLHDSELPCQLVQMNYV-GNGTVFFILP-DKGKMNTVIAALSRDTINR 287

  Fly   253 YPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFI 317
            : ...||...|.:.:||..|....:|.:.|:.|||.|||.:.::.|.:...:..:.|:|||||.:
Human   288 W-SAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVL 351

  Fly   318 EIDEEG----GSAG---SASASPIRGLSDYATSVVTFTVNSPFVFMIRDDD--NIYFRGRVVDPL 373
            :::|||    ||.|   :.::.||         ::.|  |.||:.||.|..  :..|..||::|:
Human   352 QLNEEGVDTAGSTGVTLNLTSKPI---------ILRF--NQPFIIMIFDHFTWSSLFLARVMNPV 405

  Fly   374  373
            Human   406  405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 100/384 (26%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 100/384 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.