DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SRP3

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:387 Identity:94/387 - (24%)
Similarity:163/387 - (42%) Gaps:86/387 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KQYNIIASPLCVEIGMSMILMGADG-------------NTANELRTALNLPEDKKNVATIY-DKL 80
            |..|:|.||..:...::|...|..|             ::.:||:|..     ::..:.:| |:.
plant    27 KDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVF-----RELASVVYADRS 86

  Fly    81 LTKLERGKKVAILHLANRLFVNETIGVNKRYNKL---------VNKHFRAEAEAIKLADRLKAAW 136
            .|   .|.|:.   .||.|::::::..:.::..|         |...||:|||.::.        
plant    87 AT---GGPKIT---AANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRK-------- 137

  Fly   137 AINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNV 201
            .:|.||...|.:.:||::....:|...:.:..||..|||.||..|:|..|:...||:.....|:|
plant   138 EVNSWVEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSV 202

  Fly   202 NMMSQVGRFKMRTSTIDQIIELPFAYSN------LSMVIVLPKDNGSLTQAEATIESYPQIVLTE 260
            ..||......:|.....:::.||:...:      .||...||.....|......:.|.|..    
plant   203 PFMSSYENQYVRAYDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGF---- 263

  Fly   261 MDVHV----------QLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKA 315
            :|.|:          ::|||||:|...:...|..:|::.:                   .:.|||
plant   264 LDSHIPTYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRSM-------------------SMYHKA 309

  Fly   316 FIEIDEEGGSAGSASASPIRGLS-DYA--TSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            .:||||||..|.:|:|....|.| |:.  ...:.|..:.||:|:||::  ..:.|.|::.||
plant   310 CVEIDEEGAEAAAATADGDCGCSLDFVEPPKKIDFVADHPFLFLIREEKTGTVLFVGQIFDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 92/382 (24%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 92/385 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.