DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and AT1G64010

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:227 Identity:62/227 - (27%)
Similarity:94/227 - (41%) Gaps:59/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 FFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQIIE---------LPFAY 227
            :|||.|:.:|.|..||.:.|::.....|:|::||         |..||.||         |||..
plant     2 YFKGAWEEKFHKSMTKDRDFHLINGTSVSVSLMS---------SYKDQYIEAYDGFKVLKLPFRQ 57

  Fly   228 S-----NLSMVIVLPKDNGSLTQAEATIESYPQIVLTEMDVHVQ----------LPKFKIDFRME 277
            .     |.||...||.:...|   :..:|.....| ..:|.|:.          :|||||:|...
plant    58 GNDTSRNFSMHFYLPDEKDGL---DNLVEKMASSV-GFLDSHIPSQKVKVGEFGIPKFKIEFGFS 118

  Fly   278 LVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYAT 342
            .......:|:.::                   .:..||.:||||||..|.:|:| .:.|......
plant   119 ASRAFNRLGLDEM-------------------ALYQKACVEIDEEGAEAIAATA-VVGGFGCAFV 163

  Fly   343 SVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            ..:.|..:.||:||||:|  ..:.|.|::.||
plant   164 KRIDFVADHPFLFMIREDKTGTVLFVGQIFDP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 60/222 (27%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 60/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.