DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and AT1G51330

DIOPT Version :10

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_175544.1 Gene:AT1G51330 / 841556 AraportID:AT1G51330 Length:193 Species:Arabidopsis thaliana


Alignment Length:209 Identity:44/209 - (21%)
Similarity:77/209 - (36%) Gaps:78/209 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 AEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTK 187
            ||.:::        .:|.|.|..|...:|:::.|..:|.....:..||.:|||.|:.:|.|..|.
plant    32 AEEVRM--------EVNSWALRHTNGLIKNLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMTI 88

  Fly   188 PKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIES 252
            .|.|::....||.|..|....|..|:            ||:...::.:|                
plant    89 HKPFHLVNGKQVLVPFMKSYERKYMK------------AYNGFKVLRIL---------------- 125

  Fly   253 YPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFI 317
                            ::::|::    :|.:.      |:...|::||                |
plant   126 ----------------QYRVDYK----DTSRQ------FSIDMDLNVL----------------I 148

  Fly   318 EIDEEGGSAGSASA 331
            |||||...|.:|:|
plant   149 EIDEESAEAAAATA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 serpin42Dd-like_insects 12..372 CDD:381070 44/209 (21%)
AT1G51330NP_175544.1 serpin <11..>139 CDD:476815 31/168 (18%)

Return to query results.
Submit another query.