DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and AT3G45220

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:369 Identity:92/369 - (24%)
Similarity:163/369 - (44%) Gaps:37/369 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDKLLTKLERGKKVAILHL-- 95
            |::.||:.:.:.:.:|..|::..|..::.:.:.||......|.:...:...|..|.:.:.|||  
plant    30 NLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLPSSDYLNAVLAKTVSVALNDGMERSDLHLST 94

  Fly    96 ANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAIND---WVLDQTLDNVKDIIIPS 157
            |..:::::::.....:..|:...:.|....:..|  .|.|..||:   |....|...:|:|:...
plant    95 AYGVWIDKSLSFKPSFKDLLENSYNATCNQVDFA--TKPAEVINEVNAWAEVHTNGLIKEILSDD 157

  Fly   158 DLTPDESAVMI--NAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQI 220
            .:.....:::|  ||.:|||.|..:||...||...|::.....|.|..|:...:..:......::
plant   158 SIKTIRESMLILANAVYFKGAWSKKFDAKLTKSYDFHLLDGTMVKVPFMTNYKKQYLEYYDGFKV 222

  Fly   221 IELPFA--YSNLSMVIVLPKDNGSLTQAEATIESYP---------QIVLTEMDVHVQLPKFKIDF 274
            :.||:.  ....:|.|.||.|...|......|.|.|         |.:|||.   .::||||..|
plant   223 LRLPYVEDQRQFAMYIYLPNDRDGLPTLLEEISSKPRFLDNHIPRQRILTEA---FKIPKFKFSF 284

  Fly   275 RMELVETLKSMG---------IQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSAS 330
            ..:..:.||.||         :.::..|.|....|.......:|.|.|||.||:||||..|.:.|
plant   285 EFKASDVLKEMGLTLPFTHGSLTEMVESPSIPENLCVAENLFVSNVFHKACIEVDEEGTEAAAVS 349

  Fly   331 ASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDP 372
               :..::.....:..|..:.||:|.:|::.:  |.|.|:|:||
plant   350 ---VASMTKDMLLMGDFVADHPFLFTVREEKSGVILFMGQVLDP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 89/364 (24%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 90/367 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.