DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and AT2G35580

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:386 Identity:89/386 - (23%)
Similarity:159/386 - (41%) Gaps:89/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IASPLCVEIGMSMILMGADG--NTANELRTALNLPEDKKNVATIYDKLLTKLERGKKVA---ILH 94
            :.:|| :.:.:|:|...:.|  :||:::.:.|......| :..:..:::|.:......:   .:.
plant    31 LTAPL-INVILSIIAASSPGDTDTADKIVSLLQASSTDK-LHAVSSEIVTTVLADSTASGGPTIS 93

  Fly    95 LANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKL---ADRLKAAWAINDWVLDQTLDNVKDIIIP 156
            .||.|::.:|:.|...:..|:...::|....:..   ||.:..  .:|.||..||...:.: ::|
plant    94 AANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTKADEVNR--EVNSWVEKQTNGLITN-LLP 155

  Fly   157 SD--LTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNV------------------ 201
            |:  ..|....:..||.||.|.|.::||...||...|::....:|.|                  
plant   156 SNPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFMTGASCRYTHVYEGFK 220

  Fly   202 --NMMSQVGR-----FKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLT 259
              |:..:.||     |.|:....|:...||.....|:......|||..|....|.|:        
plant   221 VINLQYRRGREDSRSFSMQIYLPDEKDGLPSMLERLASTRGFLKDNEVLPSHSAVIK-------- 277

  Fly   260 EMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGG 324
                .:::|:||.||..|..|.||..|:.                 ..:|.::||:.||:||.|.
plant   278 ----ELKIPRFKFDFAFEASEALKGFGLV-----------------VPLSMIMHKSCIEVDEVGS 321

  Fly   325 SAGSASASPIRGLS---------DYATSVVTFTVNSPFVFMIRD--DDNIYFRGRVVDPLK 374
            .|.:|:|  .||:.         |       |..:.||:|::::  ...:.|.|:|:||.|
plant   322 KAAAAAA--FRGIGCRRPPPEKHD-------FVADHPFLFIVKEYRSGLVLFLGQVMDPSK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 85/379 (22%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 86/382 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.