DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina7

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:378 Identity:101/378 - (26%)
Similarity:165/378 - (43%) Gaps:20/378 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPEDK-KNV 73
            |:...|..:|||....:|...||..||:.:...::|:..|:..:|..::...|  ||.:.. |.:
  Rat    55 SINADFAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKEL 119

  Fly    74 ATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAI 138
            ...:..|:..|........|.:.|.:|:.:.:....::...|...:..|..:...::...|...|
  Rat   120 QQGFQHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEI 184

  Fly   139 NDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKV-FYVSKSYQVNVN 202
            |.:|..||...:..:|  .||..:...:::|...||..|...|....|:... |.|.||..|.|.
  Rat   185 NSYVEKQTKGKIVGLI--QDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVP 247

  Fly   203 MMSQVGRFKMRTSTIDQIIELPFAYS-NLSMVIVLPKDNGSLTQAEATIESYP----QIVLTEMD 262
            ||.|:.::............|...|| |...:.||||: |.:...||.:.|..    ..:|.:..
  Rat   248 MMHQLEQYYHYVDVELNCTVLQMDYSANALALFVLPKE-GHMEWVEAAMSSKTLKKWNHLLQKGW 311

  Fly   263 VHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAG 327
            |.:.:|||.|....:|..||:.||::|.|..|:|...:...:|.::|...|||.:.|.|||...|
  Rat   312 VELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITKDNGLKLSYAFHKAVLHIGEEGTKEG 376

  Fly   328 SASASPIRGLSD---YATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDPLKK 375
               |||..|..|   .|.......::..|:.||  :...::.|.|:||||.|:
  Rat   377 ---ASPEAGSLDQPEVAPLHAVIRLDRTFLLMILEKRTRSVLFLGKVVDPTKE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 95/366 (26%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 100/375 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.