DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpind1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:387 Identity:109/387 - (28%)
Similarity:180/387 - (46%) Gaps:48/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQD--NKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE-----DKKNV 73
            :|...||| .|:|  ....||..:|:.:...|.||.:|..|.|..|:.:.|:..:     .|..|
  Rat   112 KFAFNLYR-VLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDFVNASSKYEV 175

  Fly    74 ATIYD---KLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAA 135
            .||::   ||..:|.|......|...|.|::.:...:.:.:...:.:.:.|||:....:|....:
  Rat   176 TTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPAFIS 240

  Fly   136 WAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVN 200
            .| |..:|..|...:|:.:..:|..  ...:::|..:|||.|..:|....|....|.:::...|.
  Rat   241 KA-NSHILKLTKGLIKEALENTDSA--TQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREVVK 302

  Fly   201 VNMMSQVGRFKMRTSTIDQ-----IIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV--- 257
            |:||...|.|   .:..||     |::|.:. ..:||:||:|:....:...||.:.  ||:|   
  Rat   303 VSMMQTKGNF---LAANDQELDCDILQLEYV-GGISMLIVIPRKLSGMKTLEAQLT--PQVVERW 361

  Fly   258 ---LTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVV-----HK 314
               :|.....|.|||||::....|||.||||||..|||.:.      |.||....:::     |:
  Rat   362 QKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNG------NMSGISDQRIIIDLFKHQ 420

  Fly   315 AFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDPLK 374
            :.|.::|||..|.:.:......||    :.|.|||:.||:|::.:...  :.|.|||.:|.|
  Rat   421 STITVNEEGTQAAAVTTVGFMPLS----TQVRFTVDRPFLFLVYEHRTSCLLFMGRVANPAK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 105/380 (28%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 107/384 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.