DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina3a

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:387 Identity:97/387 - (25%)
Similarity:182/387 - (47%) Gaps:42/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-DKKNV 73
            |:...|...||:.....|...||:.|||.:...::::.:||..||..|:...|  ||.| .:.::
Mouse    51 SINTDFAFSLYKKLALKNPHKNIVFSPLSISAALALMSLGAKDNTLEEILEGLKFNLTETPEADI 115

  Fly    74 ATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEA---------EAIKLA 129
            ...:..||..|.:.:....::..|.||:::.:.:...:.:.....::|||         ||.|| 
Mouse   116 HQNFGHLLQMLIQPENQVQINAGNALFIDKHLQILTEFKEKARALYKAEAFTADFQLPREATKL- 179

  Fly   130 DRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVS 194
                    |||:|..||...:|:::  |||..:.|..::|...|:|:|...||..:|....|.:.
Mouse   180 --------INDYVRKQTQGKIKELV--SDLHRNTSMALVNFLNFQGFWNVTFDPEDTFLGNFTLD 234

  Fly   195 KSYQVNVNMM------SQVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIE-- 251
            :...|||.||      :...|.:...||   ::||.: ..|.|.:.:|| |.|.:...|.:::  
Mouse   235 RKRTVNVPMMKTEELTTNYFRDEEMQST---VMELNY-IGNASFLFILP-DQGRIQHVEDSLQPQ 294

  Fly   252 ---SYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVH 313
               .:.:.:...|...:.||||.:.....|.:.|..:||:::|::.:|:|.:......|:||::|
Mouse   295 SLRKWRKSLRPRMLDELSLPKFSLSQDYNLNDILPELGIKEVFSTQADLSGITGAKNIRVSQMIH 359

  Fly   314 KAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDPL 373
            :|.:::.|....|...:.:.....|....:.:. .|:..|:::|.|.  .:|...|:|::||
Mouse   360 QAALDVTETHTEADVITIARYNFQSAKIKAKIV-KVDREFLYLILDPMFKSISVMGKVINPL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 93/377 (25%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 93/379 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.