DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPING1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_000053.2 Gene:SERPING1 / 710 HGNCID:1228 Length:500 Species:Homo sapiens


Alignment Length:400 Identity:100/400 - (25%)
Similarity:183/400 - (45%) Gaps:76/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TTSVLG----QFTKQLYRSFLQDNK-QYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPED 69
            |.:|||    .|:.:||.:|....| :.|:..||..:...::.:|:||..||...|.:.|:.|:|
Human   138 TEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKD 202

  Fly    70 -------KKNVATIYDKLLTKLERGKKVAILH---LANR-LFVNETIGVNKRYNKLVNKHFRAEA 123
                   .|...|   |.:|.:.:     |.|   ||.| .|||.:..:.....::::.:..|..
Human   203 FTCVHQALKGFTT---KGVTSVSQ-----IFHSPDLAIRDTFVNASRTLYSSSPRVLSNNSDANL 259

  Fly   124 EAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKP 188
            |            .||.||...|.:.:..::  ..|..|...|::||.:....|||.||...|:.
Human   260 E------------LINTWVAKNTNNKISRLL--DSLPSDTRLVLLNAIYLSAKWKTTFDPKKTRM 310

  Fly   189 KVFYVSKSYQVNVNMMSQ----VGRFKMRTSTIDQII-----ELPFAYSNLSMVIVLPKD-NGSL 243
            :.|:...|. :.|.||:.    |..|      |||.:     :|..:: |||:||::|:: ...|
Human   311 EPFHFKNSV-IKVPMMNSKKYPVAHF------IDQTLKAKVGQLQLSH-NLSLVILVPQNLKHRL 367

  Fly   244 TQAEATIE-SYPQIVLTEMDVH------VQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISV-- 299
            ...|..:. |..:.::.::::.      :.||:.|:....:::..::.:   :.|:.|.|:::  
Human   368 EDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKL---EFFDFSYDLNLCG 429

  Fly   300 LLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDNIY 364
            |......::|.:.|:..:|:.|.|..|.:|||..:      |.:::.|.|..||:|::.|..:.:
Human   430 LTEDPDLQVSAMQHQTVLELTETGVEAAAASAISV------ARTLLVFEVQQPFLFVLWDQQHKF 488

  Fly   365 --FRGRVVDP 372
              |.|||.||
Human   489 PVFMGRVYDP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 92/385 (24%)
SERPING1NP_000053.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..118
7 X 4 AA tandem repeats of [QE]-P-T-[TQ] 85..119
C1_inh 145..495 CDD:239005 92/388 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.