DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA7

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:393 Identity:106/393 - (26%)
Similarity:178/393 - (45%) Gaps:44/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPEDKK-N 72
            :|:...|...|||.|..:....||..||:.:...:.|:..||..:|..|:...|  ||.:... .
Human    43 SSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVE 107

  Fly    73 VATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWA 137
            :...:..|:..|...||...|.:.|.||:.:.:....::...|...:..|..:...::...|...
Human   108 IQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQE 172

  Fly   138 INDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTK-PKVFYVSKSYQVNV 201
            ||..|..||...|..:|  .||.|:...|::|...||..|...||...|: ...|.:.|:..|.|
Human   173 INSHVEMQTKGKVVGLI--QDLKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQV 235

  Fly   202 NMMSQVGRFKMRTSTIDQ-----IIELPFAYSNLSMVIVLPKDNGSLTQAEA-----TIESYPQI 256
            .||.|:.::   ...:|.     ::::.::.:.|:: .||||: |.:...||     |::.:.::
Human   236 PMMHQMEQY---YHLVDMELNCTVLQMDYSKNALAL-FVLPKE-GQMESVEAAMSSKTLKKWNRL 295

  Fly   257 VLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRIS----------QV 311
             |.:..|.:.:|||.|....:|..||..||||..::.::|.|.|...:|.::|          |.
Human   296 -LQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNRPAGFVLPTQA 359

  Fly   312 VHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTF-----TVNSPFVFMI--RDDDNIYFRGRV 369
            .|||.:.|.|:|   ..|:|.|...|||...:  ||     .::..|:.:|  |...:|.|.|:|
Human   360 AHKAVLHIGEKG---TEAAAVPEVELSDQPEN--TFLHPIIQIDRSFMLLILERSTRSILFLGKV 419

  Fly   370 VDP 372
            |:|
Human   420 VNP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 102/383 (27%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 102/385 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.