DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina1f

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:390 Identity:90/390 - (23%)
Similarity:182/390 - (46%) Gaps:49/390 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCWILVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL---- 64
            :|.:.:|          |::...|.:...||:.||:.|...:||:.:|::||.:..:...|    
Mouse    48 ICNVSIT----------LFKKMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNK 102

  Fly    65 -NLPEDKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKL 128
             .|||.:.:....|  ||..:.:.::.:.|...:.:|:::.:....::.|.|...:.::..:|..
Mouse   103 TGLPEAEIHKCFWY--LLHSIHQTEEPSSLQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINF 165

  Fly   129 ADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYV 193
            .|..:|...||::|::::...:.:|:  .:|..|....::|...:.....:.|...:.|.|.:::
Mouse   166 TDSSQAKTQINNYVMEKSQKEIVNIV--KNLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYHL 228

  Fly   194 SKSYQVNVNM-----MSQVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESY 253
            .....:.|.|     |..:.|.:..:||   ::.|.....|.:...::| |.|.:.:.|.:: :|
Mouse   229 GYGMTIKVPMIHNMAMHYLFRVEDLSST---VLMLTLLTGNFATYFIIP-DPGKMQKVEQSL-TY 288

  Fly   254 PQI------VLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNS---SSDISVLLNQSGTRIS 309
            |..      :||.: |.:::|:..:....:|...:..:||..:|||   |||::..|.:|    .
Mouse   289 PHFRRMRRQLLTRL-VDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDMNDTLQKS----F 348

  Fly   310 QVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRD--DDNIYFRGRVVDP 372
            :||.||.:.|||:|....:.|.....|    :|.:....:|.||:..|:|  :|...|.||||:|
Mouse   349 KVVSKAVLTIDEKGSKPSTNSCFKKLG----STDMGRMQLNRPFLIFIQDHTNDVPLFLGRVVNP 409

  Fly   373  372
            Mouse   410  409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 84/373 (23%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 89/388 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.