DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina12

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:369 Identity:98/369 - (26%)
Similarity:179/369 - (48%) Gaps:23/369 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE-DKKNVATIYDK 79
            :|..:|.:....::.|.||..|||.:....||:.:||..:|..|:|...|..| ...:|...:..
Mouse    54 EFGFKLLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWDVHAAFHY 118

  Fly    80 LLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLD 144
            ||.||.:..:...::|.|.||:::.:...:|:..|....:.|:.......|.......||.::..
Mouse   119 LLHKLNQETEDTKMNLGNALFMDQKLRPQQRFLNLAKNVYDADMVLTNFQDLENTQKDINRYISQ 183

  Fly   145 QTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGR 209
            :|...:|:::  ..:.|....::.|..:|:|.|:..||...||.:.|::.|...|.|.||.|.|.
Mouse   184 KTHSRIKNMV--KSIDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRGL 246

  Fly   210 FKMR--TSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAE----ATIESYPQIVLTEMDVHVQLP 268
            :.|.  :.....|:|:|:. .|::...||| |||.|...|    |.|.:..:.:|::..|.|.:|
Mouse   247 YDMAYDSQLSCTILEIPYR-GNITATFVLP-DNGKLKLLEQGLQADIFAKWKSLLSKRVVDVWVP 309

  Fly   269 KFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEG--GSAGS-AS 330
            |.:|.....:.:.|..:||..:|..:.|::.:.:....::.:.||||.:::||:|  |:||| |.
Mouse   310 KLRISSTYNMKKVLSRLGISKIFEENGDLTRISSHRSLKVGEAVHKAELKMDEKGMEGAAGSGAQ 374

  Fly   331 ASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            ..|:.       :.....::.||:.||.::  .::.|..|:.||
Mouse   375 TLPME-------TPRHMKLDRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 95/364 (26%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 95/364 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.