DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpina10a

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001038536.2 Gene:serpina10a / 565064 ZFINID:ZDB-GENE-041014-246 Length:391 Species:Danio rerio


Alignment Length:394 Identity:101/394 - (25%)
Similarity:201/394 - (51%) Gaps:44/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTTSVLGQ-------------FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANE 59
            |::.|||||             |..:|| |.:..:...|:..|.|...:.::.:..||.|.|.:|
Zfish    14 LLSVSVLGQTTDVEELAIKNADFATRLY-SKIASSSDDNVAVSTLGATLALATLAAGAGGATQSE 77

  Fly    60 LRTALNLPEDKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAE 124
            |...:.:....|:..  .:::...|::.::.|....|..||:.:.:..:..::..|.:::.|:.:
Zfish    78 LLQGIGVDSMVKDGE--QERIQNILQQLREDAAQIPATGLFIKQDVKADDSFSNQVKQYYNADVQ 140

  Fly   125 AIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPK 189
            .:..|:..:|..:|||:|..:|.:.|:|::  .::.|...|::|:||||.|.|...|:...|:..
Zfish   141 NVNYANGQQAKGSINDYVRGRTGEKVRDVV--ENVDPQSMAILISAAFFTGQWLQPFNATFTQED 203

  Fly   190 VFYVSKSYQVNVNMMSQVGRFKMRTSTIDQ--IIELPFAYSNLSMVIVLPKDNGSLTQAEATI-- 250
            .|||:|...|.|.||.:.|::.:......:  |::|| ..:.::|:::||.::...|..:.::  
Zfish   204 RFYVNKYNIVQVPMMLRSGKYYLAYDPTFKVGILKLP-CENGIAMLVLLPDEDVDYTYVDESMTG 267

  Fly   251 ESYPQIV--LTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVH 313
            |.:...|  |.:..:.:|||:|.:.....|..:|.|:|::::|.::::::.:.:..|.::|:|..
Zfish   268 EVFRGWVAKLKKTKLEIQLPRFSLKQSNSLSVSLPSLGVKEIFGNTANLTGISSSEGLKLSEVEQ 332

  Fly   314 KAFIEIDEEGGSAGSASAS------PIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVV 370
            |..:::||.|||...||.:      |.|           .|.|.||:|::..:..  |.:.||||
Zfish   333 KVAVDVDESGGSLAEASGNLFMNPLPPR-----------LTFNRPFIFVVYHEVTKCILYIGRVV 386

  Fly   371 DPLK 374
            ||.|
Zfish   387 DPTK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 90/379 (24%)
serpina10aNP_001038536.2 Serpin 33..388 CDD:278507 92/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.