DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpinf2a

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_688797.1 Gene:serpinf2a / 560308 ZFINID:ZDB-GENE-060822-1 Length:457 Species:Danio rerio


Alignment Length:367 Identity:106/367 - (28%)
Similarity:187/367 - (50%) Gaps:52/367 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NKQYNIIASPLCVEIGMSMILMGADGNTANELRTALN---LPEDKKNVATIYDKLLTKLERGKKV 90
            ::|.|||.|||.|.:.::.:.:||..||..:|...|:   ||...:.::.:.:.|..|       
Zfish    62 SEQPNIIISPLSVSLALAELALGARNNTEEKLLEVLHAKELPHFHETLSCLQEHLTAK------- 119

  Fly    91 AILHLANRLFVNETIGVNKRY-NKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLDNVKDII 154
             .:.:|:||::.....||..: ::.:|.:....|:...:.|       :|.||.:.|...:.:.:
Zfish   120 -AVKMASRLYLVPGYTVNPDFVDRALNLYKSESAQLTSIED-------VNRWVEETTNGQITNFM 176

  Fly   155 IPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMM--SQ--VGRFKMRTS 215
              |.|.|:...::|||..|||.|::||:...||..:|::.:...|.|:||  ||  :..|..||.
Zfish   177 --SSLPPNVVLMLINAIHFKGEWQSRFNSKYTKENIFHIDRKTSVKVDMMMGSQYPLSMFVDRTD 239

  Fly   216 TIDQIIELPFAYSNLSMVIVLPK---DNGSLTQAEATIES----YPQIVLTEMDVHVQLPKFKID 273
            . .|:..|||. .|:|:::::|:   :|.|...|:..|..    :|:    |..:||.|||||::
Zfish   240 G-TQVARLPFR-GNMSLLVIMPRLQHENLSNVAAKLNISDMYARFPR----ERSMHVTLPKFKLE 298

  Fly   274 FRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLS 338
            ::.:|.:.|.|||:..|| :..|:| .:......:|.|.|.:.:|:.|||..|.:|::..:    
Zfish   299 YKQDLRQALTSMGLGFLF-TGPDLS-RIAPGPLVVSGVQHASNMELSEEGAEASAATSFTL---- 357

  Fly   339 DYATSVVTFTVNSPFVFMIRDDDNI--YFRGRVVDPLKKSNP 378
              ..::..|:||.||:|.:.||.:.  .|.|.|.:|    ||
Zfish   358 --VRTISFFSVNMPFIFALVDDTSYTPLFLGIVTNP----NP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 102/356 (29%)
serpinf2aXP_688797.1 SERPIN 54..388 CDD:294093 102/356 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.