DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpinh1a

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001103844.1 Gene:serpinh1a / 555328 ZFINID:ZDB-GENE-080219-21 Length:403 Species:Danio rerio


Alignment Length:364 Identity:91/364 - (25%)
Similarity:182/364 - (50%) Gaps:20/364 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDK-KNVATIYDKLLTKL 84
            ||::..:|....||:.||:.|...:.::.:|...|||::::|.|:....| :.:.:...:|||::
Zfish    39 LYQNMAKDKDIENILISPVVVASSLGLVALGGKSNTASQVKTVLSAASVKDEQLHSGLSELLTEV 103

  Fly    85 ERGK-KVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLD 148
            ...| :.....::||.:...::.....:.|...||:..:...|...|:..|..|||||....|..
Zfish   104 SNPKARNVTWKISNRFYGPSSVSFVDDFLKSSKKHYNYDHSKINFRDKRSAVKAINDWASKSTDG 168

  Fly   149 NVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMR 213
            .:.:  :..|:...:.|::|||.|:|.:|..:|.......:.|.|.:|:.|:|.||.:.|.:...
Zfish   169 KLPE--VTKDVEKTDGAMIINAMFYKPHWNEQFHHKMVDNRGFLVHRSFTVSVPMMHRTGIYGFL 231

  Fly   214 TSTIDQ--IIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQI-----VLTEMDVHVQLPKFK 271
            ..|.::  ::|:|.|:...|:|:::|....||.:.|..: :..|:     .:.:..|.:.|||..
Zfish   232 DDTTNKLLVLEMPLAHKMSSLVLIMPYHVESLERVEKLL-TRQQLNTWVSAMEQKAVAISLPKVS 295

  Fly   272 IDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIR 335
            ::....|.:.|..:|:.:..: :.:|:|.:..:....:|.|.|.:.:|.|.||....::    |.
Zfish   296 MEVSHNLQKHLAELGLTEAVDKAKADLSNISGKKDLYLSNVFHASAMEWDTEGNPPDTS----IF 356

  Fly   336 GLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            | :|...:...|..:.||||:::|:  ::|.|.||::.|
Zfish   357 G-TDQLKNPKLFYADHPFVFLVKDNKTNSILFMGRLIRP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 89/359 (25%)
serpinh1aNP_001103844.1 SERPIN 26..391 CDD:294093 89/359 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.