DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINB8

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:371 Identity:112/371 - (30%)
Similarity:191/371 - (51%) Gaps:18/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDK 79
            |.|...|::...:::...|:..||:.:...::|:.|||.|:||.::..||.|.:| .::...:..
Human     9 GTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKD-GDIHRGFQS 72

  Fly    80 LLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLA-DRLKAAWAINDWVL 143
            ||:::.|.....:|..|||||..:|......:.:...|.::||.|.:..| |..:....|||||.
Human    73 LLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVA 137

  Fly   144 DQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVG 208
            ::|...:.:::....:.|....|::||.:|||.|..:||:..|:..:|..::. :..|.||.:..
Human   138 EKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEE-KKTVQMMFKEA 201

  Fly   209 RFKM--RTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQI-------VLTEMDVH 264
            :|||  ......|::|||:....|||||:||.||..|...|..: :|.:.       .||:..|.
Human   202 KFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKAL-TYEKFKAWTNSEKLTKSKVQ 265

  Fly   265 VQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGS 328
            |.||:.|::...:|...|:.:|:.|.|: :.:|.|.:..:....:|:|.||.|:|::|||..|.:
Human   266 VFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAA 330

  Fly   329 ASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDP 372
            |:| .:|. |..:.....|..:.||:|.||....  |.|.||...|
Human   331 ATA-VVRN-SRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 109/365 (30%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 111/369 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.