DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINE2

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens


Alignment Length:375 Identity:111/375 - (29%)
Similarity:186/375 - (49%) Gaps:35/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDKLLTKL 84
            |::...::.....||:.||..:...:.|:.:||||.|..:|  |:.:......|..|..|:...:
Human    49 QVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKKQL--AMVMRYGVNGVGKILKKINKAI 111

  Fly    85 ERGKKVAILHLANRLFVNETIGVNKRY---NKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQT 146
            ...|...|:.:||.:||.....:...:   ||.|   |:.|...:...|...|..:||.||.::|
Human   112 VSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDV---FQCEVRNVNFEDPASACDSINAWVKNET 173

  Fly   147 LDNVKDIIIPSDLTPD--ESAVMINAAFFKGYWKTRFDKMNTKPKVFYVS--KSYQVNVNMMSQV 207
            .|.:.:::.| ||...  ...|::||.:|||.||:||...|||.:.|..:  ||||  |.|::|:
Human   174 RDMIDNLLSP-DLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQ--VPMLAQL 235

  Fly   208 GRFKMRTSTID-----QIIELPFAYSNLSMVIVLPKDNGSLTQA------EATIESYPQIVLTEM 261
            ..|:..:::..     ..||||:...::||:|.||.::.:...|      ..||:|:..|::.:.
Human   236 SVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKR 300

  Fly   262 DVHVQLPKFKIDFRMELVETLKSMGIQDLFNSS--SDISVLLNQSGTRISQVVHKAFIEIDEEGG 324
             |.|.||||....:.:|.|.||.:||.|:|:||  :...:........:|.::.||.||:.|:|.
Human   301 -VQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSEDGT 364

  Fly   325 SAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDP 372
            .|.:|:.:.:...|    |...|.|:.||:|.||.:..  :.|.|::..|
Human   365 KASAATTAILIARS----SPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 110/370 (30%)
SERPINE2XP_005246698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.