DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA4

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:401 Identity:102/401 - (25%)
Similarity:179/401 - (44%) Gaps:75/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-DKKNVATIYD 78
            |..:.|.....:....||..|||.:....:|:.:||..::.:::...|  ||.| .:.:|...:.
Human    95 FAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQ 159

  Fly    79 KLLTKLE---RGKKVAI---LHLANRL-----FVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL 132
            .||..|.   .|.:..:   |.|::.|     |:|:|:.|.:.  ||.:.:|......|:|    
Human   160 HLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEA--KLFHTNFYDTVGTIQL---- 218

  Fly   133 KAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSY 197
                 |||.|..:|...:.|::  |:|..|...|::|..:||..|:..|....|.||.|||.::.
Human   219 -----INDHVKKETRGKIVDLV--SELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENT 276

  Fly   198 QVNVNMMSQVGRFKMRTSTIDQ--------------IIELPFAYSNLSMVIVLPKDNGSLTQAEA 248
            .|.|.||.|           ||              ::.:.:. .:.::..:|| :.|.:.:.|.
Human   277 TVRVPMMLQ-----------DQEHHWYLHDRYLPCSVLRMDYK-GDATVFFILP-NQGKMREIEE 328

  Fly   249 TIESYPQIVL------------TEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLL 301
            .:.  |::::            .::::|  ||||.|.....|.:.|..:|..|||:..:|:|.:.
Human   329 VLT--PEMLMRWNNLLRKRNFYKKLELH--LPKFSISGSYVLDQILPRLGFTDLFSKWADLSGIT 389

  Fly   302 NQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYAT-SVVTFTVNSPFVFMI--RDDDNI 363
            .|.....|:..|||.:::||.|..|.:|::..|:..|.... .::.|  |.||:.:|  ....::
Human   390 KQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRF--NRPFLVVIFSTSTQSV 452

  Fly   364 YFRGRVVDPLK 374
            .|.|:||||.|
Human   453 LFLGKVVDPTK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 97/394 (25%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 97/394 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.