DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:380 Identity:104/380 - (27%)
Similarity:182/380 - (47%) Gaps:27/380 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALN-----LPEDK 70
            |..|.:|...|||.....:...||..||:.:....:|:.:|...:|.:|:...||     :||  
Human    51 TPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPE-- 113

  Fly    71 KNVATIYD---KLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL 132
               |.|::   :||..|.:......|...|.||::|.:.:..::.:.|.|.:.:||..:...|..
Human   114 ---AQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTE 175

  Fly   133 KAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSY 197
            :|...|||:|...|...:.|::  .:|..|....::|..||||.|:..|:..:|:.:.|:|.:..
Human   176 EAKKQINDYVEKGTQGKIVDLV--KELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVT 238

  Fly   198 QVNVNMMSQVGRFKMR-TSTIDQIIELPFAYSNLSMVIVLPKDNGSL--TQAEATIESYPQIVLT 259
            .|.|.||.::|.|.:: ...:...:.|.....|.:.:..|| |.|.|  .:.|.|.:...:.:..
Human   239 TVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLP-DEGKLQHLENELTHDIITKFLEN 302

  Fly   260 E--MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEE 322
            |  ....:.|||..|....:|...|..:||..:|::.:|:|.:..::..::|:.||||.:.|||:
Human   303 EDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEK 367

  Fly   323 GGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDPLKK 375
            |..|  |.|..:..:.......|.|  |.||||::  ::..:..|.|:||:|.:|
Human   368 GTEA--AGAMFLEAIPMSIPPEVKF--NKPFVFLMIEQNTKSPLFMGKVVNPTQK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 98/367 (27%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 98/368 (27%)
RCL 368..392 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.