DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA5

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:384 Identity:101/384 - (26%)
Similarity:185/384 - (48%) Gaps:37/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNL---PEDK 70
            |..|....||..|||:........:|..||:.:.:.::|:.:||..:|..::...|.|   ...:
Human    40 VAPSSRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSE 104

  Fly    71 KNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAA 135
            |.:...:.:||.:|.:.:....|.|.|.||.:..:.:...:...:...:.|:.......|...|.
Human   105 KELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAM 169

  Fly   136 WAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVN 200
            ..|||:|..||...:.|::  .:|..:...:|:|..|||..|:|.|:...|:.:.|||:....|.
Human   170 KQINDYVAKQTKGKIVDLL--KNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVR 232

  Fly   201 VNMMSQVGRFK--MRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQ-----AEATIESYPQIVL 258
            |.|||:..::.  :..:...:::.:|: ..|.:.:.:||.: |.:.|     :|.|:..:.: :.
Human   233 VPMMSREDQYHYLLDRNLSCRVVGVPY-QGNATALFILPSE-GKMQQVENGLSEKTLRKWLK-MF 294

  Fly   259 TEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEG 323
            .:..:.:.||||.|:...:|.:.|.|:||.::|.|.:|:|.:.|.|..::|::||||.:|:||.|
Human   295 KKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESG 359

  Fly   324 GSAGSASASPIRGLSDYATSVVTF----------TVNSPFVFMIRDDDNIYFRGRVVDP 372
            ..|.:|:.           ::.||          ..|.||:..| .|:||.|.|:|..|
Human   360 TRAAAATG-----------TIFTFRSARLNSQRLVFNRPFLMFI-VDNNILFLGKVNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 97/372 (26%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 97/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.