DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINE1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:386 Identity:89/386 - (23%)
Similarity:179/386 - (46%) Gaps:40/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CWILVTTSVLGQ-----------------FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGA 52
            |.:|....|.|:                 |..::::...|.:|..|::.||..|...::|:.:..
Human     9 CLVLGLALVFGEGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTT 73

  Fly    53 DGNTANELRTALNLPEDKKNVAT----IYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNK 113
            .|.|..:::.|:....|.|.:|.    :|.:|:....:.:    :...:.:||...:.:.:.:..
Human    74 GGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDE----ISTTDAIFVQRDLKLVQGFMP 134

  Fly   114 LVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWK 178
            ...:.||:..:.:..::..:|.:.|||||...|...:.:::....:......|::||.:|.|.||
Human   135 HFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWK 199

  Fly   179 TRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTID-----QIIELPFAYSNLSMVIVLPK 238
            |.|...:|..::|:.|....|:|.||:|..:|.....|..     .|:|||:....|||.|..|.
Human   200 TPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPY 264

  Fly   239 DN----GSLTQ-AEATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNS-SSDI 297
            :.    .:||. ..|.:.|:.:..:|.:...:.||||.::..::|.:.|:::|:.|:|.. .:|.
Human   265 EKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF 329

  Fly   298 SVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIR 358
            :.|.:|....::|.:.|..||::|.|..|.|::|..:..    ..:.....::.||:|::|
Human   330 TSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIVSA----RMAPEEIIMDRPFLFVVR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 85/375 (23%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 85/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.