DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpinb5

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:389 Identity:117/389 - (30%)
Similarity:182/389 - (46%) Gaps:35/389 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKN 72
            |..|::.....|:|......|    |.:.||||:...:|:|..|:.||||:||..||:. |..|:
 Frog     6 LANTALAVDIFKKLCEKSATD----NFVCSPLCISSSLSLIRKGSQGNTASELEKALHF-EKVKD 65

  Fly    73 VATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL-KAAW 136
            ....:..|.:.:.:......|.|..|::|:.:|...|.:.....|.:..|.|.|....:. :|..
 Frog    66 PDFGFQLLSSDISKISSANSLKLLKRVYVDNSIECKKDFINSAKKPYPLELETIDFKSQAEEART 130

  Fly   137 AINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNV 201
            .||..|.:.|..|.:.::.......:...:|:.||.|||.|...|:|..||...|:::|.....|
 Frog   131 QINSSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFHINKKETKPV 195

  Fly   202 NMMSQVGRF------KMRTSTIDQIIELPFAYSNLSMVIVLPK----DNGSLTQAE--ATIESYP 254
            .||....|.      :::|    .::|:||...:.||:|:|||    |:..|.:.|  .|.|.|.
 Frog   196 QMMHLEARLSIGYINELKT----MVLEMPFQSKHFSMLILLPKDIEDDSTGLKKLEQDMTFEKYT 256

  Fly   255 Q----IVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHK 314
            .    .::....|.|.|||||::...:|.:.|||:||.|.|| .:||.|.:....|..|||.:.|
 Frog   257 HWTNPSMMANSKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTESKGISISQAIQK 321

  Fly   315 AFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDD--NIYFRGRVVDPLKKS 376
            |.||:||:|  ..||..|..|.|.:..    .|..:.||::::|.:.  .|...||...|.:.|
 Frog   322 ACIEVDEDG--TESADVSMERRLMNKE----EFLADHPFIYILRHNKTRTIIMLGRYCGPSEAS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 112/372 (30%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 115/383 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2443
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3392
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.