DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:381 Identity:107/381 - (28%)
Similarity:203/381 - (53%) Gaps:30/381 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNL----PEDKKNVATI 76
            ||:..|::.....|...|:..||:.:...::|:.:||.||||:::...|..    .:..:.:.:.
Zfish    10 QFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVEQIHSN 74

  Fly    77 YDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWA-IND 140
            :.|.:::|.:.:...:|.|||||:..:|..:.:::.....:::.|..|.:...::.:.|.. ||.
Zfish    75 FKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINT 139

  Fly   141 WVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMS 205
            ||...|.:.:||::....:......|::||.:|||.|:.:|.|..|:..||.::|:....|.||.
Zfish   140 WVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMH 204

  Fly   206 QVGRF------KMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIE---SYPQI----- 256
            |...|      :|::    .::|||:|..||||:|:||.:....|.....:|   :|.::     
Zfish   205 QKAEFPSGYIEEMKS----HVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTK 265

  Fly   257 --VLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSS-DISVLLNQSGTRISQVVHKAFIE 318
              |:.:.:|.|.|||||.:...::...|.|||::|:|:... :::.:.:.:...:|:.:||||:|
Zfish   266 PEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFVE 330

  Fly   319 IDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            ::|||..|.:|:|: |..|..|... ::|..:.||:|.||.:  .:|.|.||:..|
Zfish   331 VNEEGTEAAAATAA-IEKLMCYIPP-LSFNADHPFLFFIRHNPTKSILFYGRLCSP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 105/376 (28%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 106/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.