DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:381 Identity:113/381 - (29%)
Similarity:178/381 - (46%) Gaps:57/381 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NIIASPLCVEIGMSMILMGADGNTANELRTALNL--PEDKKNVATIYDKLLTKLERGKKVAILHL 95
            |:..||......:.:....:...|..||..||||  ..:|:.|...|.....:.|...:.:.:.|
  Fly    57 NLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMEL 121

  Fly    96 --ANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSD 158
              |||:||:.||.|:.::|.|:   :.|..|.....|.......||||:.|:|.:.::|::...:
  Fly   122 SSANRIFVDRTINVSNKFNTLL---YGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEE 183

  Fly   159 LTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTID----- 218
            :||....|:.|||:.||.|.::|....|..|.|::::..|..|.||.:.|.|||   |||     
  Fly   184 ITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKM---TIDEGLQS 245

  Fly   219 QIIELPF---------------AYSNLSMVIVLPKDNG-SLTQAEATI----------ESYPQIV 257
            |||:||:               :.|::||:|:||..|. ||.:..:.:          .:.||  
  Fly   246 QIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQ-- 308

  Fly   258 LTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVV----HKAFIE 318
                .:.:.||||:.:.|:||...|..||:..:|..::....|   :...||.|:    |.|.|:
  Fly   309 ----KIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDL---TADPISLVIDDAQHLAKIK 366

  Fly   319 IDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            :||.|.:|.:|:...: ..|........|..|.||||:|.|:  |.|.|.|...||
  Fly   367 VDEVGSTAAAATILLV-SRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 111/376 (30%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 111/376 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.