DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Acp76A

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:392 Identity:91/392 - (23%)
Similarity:169/392 - (43%) Gaps:60/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WILVTTSVLGQFTKQLYRSF--LQDNKQY---NIIASPLCVEIGMSMILMGADGNTANELRTAL- 64
            ::::.||:|.|.|.|...||  :::..:|   |.:.|.|.:|:.:..|.......:.|:|..:| 
  Fly     8 FLVLCTSLLFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLI 72

  Fly    65 ---NLPEDKKNVATIYDKLLTKLERG---KKV--AILHLANRLFVNETIGVNKRYNKLVNKHFRA 121
               ...|.::.|          |:.|   ||.  |...:||::.|::.:.::::. :|||:....
  Fly    73 INFGYSEARQEV----------LDWGLRYKKASSAKFQMANKVAVSQKLPLSQKL-RLVNEVLMT 126

  Fly   122 EAEAIKLADRLKAAWAINDWVLDQTLDNV-KDIIIPSDLTPDESAVMINAAFFKGYWKTRF-DKM 184
            .|:...:...::.:..:::| |...||.| .:.:....|...|:.|.|:.......|.:.| .::
  Fly   127 SAKKYDVTKDVRPSKLMDEW-LSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEI 190

  Fly   185 N----TKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQ 245
            |    ..|...|.||. ...|.||..:..|:..::...:.|.:||:.:||.|:|:||:...:...
  Fly   191 NRYFVNNPGTGYASKD-PTCVPMMHSLSSFETMSTDEAKGIYIPFSSANLGMLILLPRKGVTCKD 254

  Fly   246 AEATIESYPQIVLTE-MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSS---SDISVLLN---- 302
            ....:.:...:...: .|||:.||.||..|...:.:....:.|:|.|..|   |...:.:|    
  Fly   255 ILDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRV 319

  Fly   303 QSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDNIYFRG 367
            ..|.|...::....::..:.|                   ...||.||.||||:|:|..|:|..|
  Fly   320 NHGIRFQPILRLEVVDDIDTG-------------------KTETFEVNRPFVFVIKDKINVYAVG 365

  Fly   368 RV 369
            |:
  Fly   366 RI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 87/380 (23%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 85/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.