DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb3d

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:383 Identity:107/383 - (27%)
Similarity:199/383 - (51%) Gaps:31/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQ-DNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE----------- 68
            :||.:|||...: ||   ||..||:.:...::|:|:||..||..:::..|:..|           
Mouse    10 KFTLELYRQLRESDN---NIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETTKKTTEKSAE 71

  Fly    69 --DKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADR 131
              |::||...:..|:|:|.:......|.:.|.::..:.....:.:.|.:.|:::|..|::..|..
Mouse    72 SHDEENVHQQFQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVESLDFAHA 136

  Fly   132 LKAAW-AINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSK 195
            .:.:. .||.|:..||...:||:.....|......|::||.:|||.|..:||:.:|:.:.|:::|
Mouse   137 AEESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREEKFWLNK 201

  Fly   196 SYQVNVNMMSQVGRFK--MRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVL 258
            :....|.||.|..:|.  ...:...:|:|:|:....|||.::||.:...|.:.|..:.:...:..
Mouse   202 NTSKPVQMMKQRNKFNFIFLENVQAKIVEIPYKGKELSMFVLLPVEIDGLKKFEEQLTADKLLQW 266

  Fly   259 TE------MDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAF 316
            |.      .::::.||:||::.:.:|...|:.||:.|.|: ..:|.|.:.|..|..:|:|:||:|
Mouse   267 TRAENMHMTELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFSGMSNSQGLVVSKVLHKSF 331

  Fly   317 IEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            :|::|||..|.:|.:...|.||  ......|:.|.||:|:::.:  ::|.|.|||..|
Mouse   332 VEVNEEGAEAATAMSVESRSLS--VPKPNDFSCNHPFLFVMKQNKTNSILFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 104/378 (28%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 106/381 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.