DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpine2

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:399 Identity:123/399 - (30%)
Similarity:205/399 - (51%) Gaps:46/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCWILVTTSVLGQFTK-------QLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELR 61
            ||.:.|:.|....:..       |::...|||..|.|::.||..|...:.|:|.||.|:|..:| 
Zfish    13 LCSVSVSQSQSSSYGARGSDLGLQVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQL- 76

  Fly    62 TALNLPEDKKNVATIYDKLLTKLERG----KKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAE 122
              ||..:.|||...   |:|.||.:.    ....|:.:||.||.||...:.:.:.....::|..|
Zfish    77 --LNGLKYKKNGPY---KMLRKLHKSLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCE 136

  Fly   123 AEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPD--ESA----VMINAAFFKGYWKTRF 181
            :.::..:|...||.:|||||.:.|...     |||.:|.|  ::|    |.:|:.||||.||:||
Zfish   137 SHSVDYSDPEAAAQSINDWVKNSTKGQ-----IPSVVTADMFDTALTRLVAVNSIFFKGLWKSRF 196

  Fly   182 DKMNTKPKVFYVSKSYQVNVNMMSQVGRFKM-RTSTIDQ----IIELPFAYSNLSMVIVLP-KDN 240
            ...:|||:.|.........|.||||:..|.| :.||.|.    :||||:..:::||.|.|| :|:
Zfish   197 QPQSTKPRSFTAGDGNTYKVPMMSQLSVFNMGQASTPDGQKYIVIELPYHGNSMSMFIALPTEDS 261

  Fly   241 GSLTQ-----AEATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVL 300
            ..|:.     :..||:|:.:: :....:.:.:|||.::..::|...||::||:|:|:.:......
Zfish   262 TPLSSILPHISTNTIQSWTKL-MNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRH 325

  Fly   301 LNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--I 363
            |:.....:|:.:.||.||::|:|..|.:.::..:...|    |....||:.||:|:||.:.:  |
Zfish   326 LSSESIYVSKALQKAKIEVNEDGTKASATTSVILHARS----SPPWVTVDRPFLFLIRHNSSGTI 386

  Fly   364 YFRGRVVDP 372
            .|.|::..|
Zfish   387 LFAGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 118/382 (31%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 118/384 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.