DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:384 Identity:104/384 - (27%)
Similarity:196/384 - (51%) Gaps:33/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE------------ 68
            :|..::||...:.:|  ||..||:.:...::|:.:||.|||..::...|...|            
Mouse    10 KFAVEMYRQLRESDK--NIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHC 72

  Fly    69 -DKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL 132
             |::||...:.||:|:|.:......|..||.::..:.....:.:.:.:.::::|:.|::......
Mouse    73 DDEENVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEHAT 137

  Fly   133 -KAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKS 196
             ::...||.||..:|...:||:.....|:.....|::||.:|||.|..:|::.:|:.:.|:::|:
Mouse   138 EESEKKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKFWLNKN 202

  Fly   197 YQVNVNMMSQVGRFKMR--TSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIES------- 252
            ....|.||.|..:|...  .....||:|:|:...:|||.::||.:...|.|.|..:.:       
Mouse   203 TSKPVQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWI 267

  Fly   253 -YPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKA 315
             ...:.|||:  ::.||:||::.:.:|...|:.||:.|.|: ..:|.|.:.:..|..:|:|:||:
Mouse   268 KAENMHLTEL--YLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHKS 330

  Fly   316 FIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDP 372
            |:|::|||..|.:|:...:...|  |.....|..:.||:|.|  |..::|.|.||:..|
Mouse   331 FVEVNEEGTEAAAATGVEVSVRS--AQIAEDFCCDHPFLFFIIHRMTNSILFFGRICSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 102/379 (27%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 103/382 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.