DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Spn53F

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:372 Identity:93/372 - (25%)
Similarity:168/372 - (45%) Gaps:34/372 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL-----NLPEDKKNVAT 75
            |...:||.:.:......||:.|...:...|..|.:|.:.:.:.::|.|:     :|.|.|.....
  Fly    21 QLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQK 85

  Fly    76 IYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLA-DRLKAAWAIN 139
            |:...:      ||..:.....|.:|.:.:.::..| ::..:|....|..|..| ::|.   .:|
  Fly    86 IFAMSV------KKAPVAKSLTRFYVRQNMKMSTEY-RVFMRHTEGRARNIAFAREQLD---EVN 140

  Fly   140 DWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMM 204
            .:...:..:.:..::..|...|:...:::||.||...|:..|:...|.|:.|.|:.:..|.:.||
  Fly   141 TFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMM 205

  Fly   205 SQVGRF------KMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV----LT 259
            .:..:|      .::.:.    :.:||::.:|.|:::.|.....|...:..:::...:.    ||
  Fly   206 HEDSKFAFGILGNLKATA----VLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLT 266

  Fly   260 EMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQ-SGTRISQVVHKAFIEIDEEG 323
            .|||.|.:|||||...:||....:.|||:|:|..|...|.||:: :..||..|:|....|..|:|
  Fly   267 MMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQG 331

  Fly   324 GSAGSASASPIRG-LSDYATSVVTFTVNSPFVFMIRDDDNIYFRGRV 369
              .|:.|.....| |:.....|..|....||.|.|.|:.:|||.|.|
  Fly   332 --IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFAGHV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 92/370 (25%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 91/366 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.