DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina11

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:419 Identity:100/419 - (23%)
Similarity:184/419 - (43%) Gaps:67/419 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVAT 75
            |..:..|..:||:. |.:....||:.||:.:...::::.:||..:|..::..:|.....:...|.
  Rat    51 TPTITNFALRLYKQ-LAEEIPGNILFSPVSLSSTVALLSLGAHADTQAQILQSLGFNLTETPAAD 114

  Fly    76 I---YDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWA 137
            |   :..||..|:.......|.|.:.||::..:...:|:.....:.:.|.|.:....:.......
  Rat   115 IHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATGQQ 179

  Fly   138 INDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNT-KPKVFYVSKSYQVNV 201
            |||.|..||...|...:  .:...|...|::|..|||..||..||:..| |.:.|:|.:..|:.:
  Rat   180 INDLVRKQTYGQVVGCL--PEFDRDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFFVDQRLQLRI 242

  Fly   202 NMMSQ--VGRF---KMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIE---------- 251
            .||.|  :.||   :..:.|:.||     .||..::::::..|.|.:.|.||.::          
  Rat   243 PMMRQKEMHRFLYDQEASCTVLQI-----EYSGTALLLLVLPDPGKMQQVEAALQPETLRRWGQR 302

  Fly   252 ----------------------SYPQ----------IVLTE----MDVHVQLPKFKIDFRMELVE 280
                                  .:||          :.:|:    :|:|  ||:|.:.....|.|
  Rat   303 FLPRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTWSLLDLH--LPRFSVSATYNLEE 365

  Fly   281 TLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVV 345
            .|..:|:..||:..:|:|.::.|....:|:|.|||.::::|:|..|.:||....:..|...||..
  Rat   366 ILPLVGLSSLFDVEADLSGIMGQLNKTVSRVSHKAVVDMNEKGTEAAAASGLLSQPPSLNMTSAP 430

  Fly   346 TFTVNSPFVFMIRD--DDNIYFRGRVVDP 372
            ....|.||:.::.:  ..::.|.|:||:|
  Rat   431 HAHFNRPFLLLLWEVTTQSLLFLGKVVNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 96/409 (23%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 96/412 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.