DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Spn28Dc

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:450 Identity:99/450 - (22%)
Similarity:186/450 - (41%) Gaps:113/450 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKK 71
            :|...::|||        .|.:.|..  |.|||.:...::::|:||.|.:..||.|..::| |..
  Fly   112 VLNFANILGQ--------HLANGKTQ--IYSPLSIVHSLALLLLGAKGRSYEELSTVFDIP-DTS 165

  Fly    72 NVATIYDKLLTKLERGKKVAI----------------------------LHLANRLFVNETIGVN 108
            .:...:..:|..|::..:.||                            :||||.||......:|
  Fly   166 RLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLN 230

  Fly   109 KRYNKLVNKHFRAEAEAIKLAD----RLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMIN 169
            ..|.:::.:.:   |..:::.|    ...|.:.||.:|...|.::::: ||.||:......::.|
  Fly   231 PDYRRVIVEVY---ASDLQIQDFEGSPATARYNINAYVAQHTKNHIEN-IIASDIPQTTRMILAN 291

  Fly   170 AAFFKGYWKTRFDKMNTKPKVFYVS---KSYQVNVNMMSQVGRFKMRTSTID-----QIIELPFA 226
            |.:||.:|:|.|.:..|:|..||.:   ....:.|.||:..|.:....   |     :||.||:.
  Fly   292 ALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHE---DHELGCKIIGLPYR 353

  Fly   227 YSNLSMVIVLPKDNGSLTQAEA--------TIES-----YPQIVLTEMDVHVQLPKFKIDFRMEL 278
             .|||.:.::.....|:.:..|        .|||     |.:..|      |..||..:...:.|
  Fly   354 -GNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAAL------VAFPKMHLTESVNL 411

  Fly   279 VETLKSMGIQDLFNS-SSDISVLLNQSGTR----------------------------ISQVVHK 314
            ...::.||:..:|:: .:|:|::.....||                            :..:|||
  Fly   412 KTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHK 476

  Fly   315 AFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDP 372
            ....::|:|..|.::|.:.::    .:...|.|..::||:.::|.|..  :.|.|.:.:|
  Fly   477 VDFTVNEQGTEAAASSVTYLK----KSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 95/436 (22%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 97/443 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.