DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina7

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:386 Identity:98/386 - (25%)
Similarity:164/386 - (42%) Gaps:36/386 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATI 76
            |:...|...|||....:|...||..||:.:.:.::|:..|:..:|..::...|..        .:
Mouse    55 SINADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGF--------NL 111

  Fly    77 YDKLLTKLERG-----------KKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLAD 130
            .|..:|:|::|           |....|.:.|.:|:.:.:....::...|...:..|..:...::
Mouse   112 TDTPVTELQQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSN 176

  Fly   131 RLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKV-FYVS 194
            ...|...||.:|..||...:..:|  ..|..:...:::|...|:..|...|....|:... |.|.
Mouse   177 VSAAQHKINSYVEKQTKGKIVGLI--QGLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVD 239

  Fly   195 KSYQVNVNMMSQVGRFKMRTSTIDQIIELPFAYS-NLSMVIVLPKDNGSLTQAEATIESYP---- 254
            ||..|.|.||.|:.::............|...|| |...:.||||: |.:...||.:.|..    
Mouse   240 KSTTVQVPMMHQLEQYYHYVDMELNCTVLQMDYSENALALFVLPKE-GHMEWVEAAMSSKTLKKW 303

  Fly   255 QIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEI 319
            ..:|.:..|.:.:|||.|....:|..||:.||::|.|..|:|...:...||.::|...|||.:.|
Mouse   304 NYLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITEDSGLKLSYAFHKAVLHI 368

  Fly   320 DEEGGSAGSASASPIRGLSDYATSVVTFTV---NSPFVFMI--RDDDNIYFRGRVVDPLKK 375
            .|||...|   |||..|..|.........|   :..|:.||  :...::.|.|::|:|.|:
Mouse   369 GEEGTKEG---ASPEVGSLDQQEVPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLVNPTKQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 94/374 (25%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 93/375 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.