DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA9

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:371 Identity:99/371 - (26%)
Similarity:163/371 - (43%) Gaps:18/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NL---PEDKKNVATI 76
            |..:|||..:.:....||..||:.|...::|:.:||...|..::...|  ||   ||..  :...
Human    51 FAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESA--IHQG 113

  Fly    77 YDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDW 141
            :..|:..|....|...|.:.:.|||.:.:.:...:...|.:.:.||..:...::...|...||..
Human   114 FQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSH 178

  Fly   142 VLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKV-FYVSKSYQVNVNMMS 205
            |..:|...|.|||...||.  .:.|::|..|||..|:..|....|:... |.|.:...|:|.||.
Human   179 VKKKTQGKVVDIIQGLDLL--TAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMH 241

  Fly   206 QVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAE-----ATIESYPQIVLTEMDVHV 265
            |..:|.....|......|...|...::...:....|.:.|.|     .|:..:.. .|.:..:.|
Human   242 QKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSH-SLQKRWIEV 305

  Fly   266 QLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSAS 330
            .:|:|.|.....|...|..||||::|:.::|.|.:..:...::|:..|||.:::.|||..|.:|:
Human   306 FIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAAT 370

  Fly   331 ASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDPLK 374
            .:.....|....|..|.:.|..|:.||  :..|.|.|.|:|.:|.|
Human   371 TTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 96/364 (26%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.