DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpina1l

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001013277.3 Gene:serpina1l / 321195 ZFINID:ZDB-GENE-040721-3 Length:433 Species:Danio rerio


Alignment Length:383 Identity:101/383 - (26%)
Similarity:186/383 - (48%) Gaps:29/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CWILVTTSVLGQFTKQLYRSFLQ--DNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALN-- 65
            |.:|...:  ..|...||:....  |.:..||..||:.:.:.:|::.:||.|:|.:::.:.|.  
Zfish    63 CHLLAPHN--ADFAFSLYKKLASNPDAQGKNIFFSPVGISMALSLLAVGAKGSTLSQIYSGLGYS 125

  Fly    66 --LPEDKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKL 128
              .||   .|...|:.||..|...:....|.....:.:.:...|..::.|....::.:||..:..
Zfish   126 ALTPE---QVNEGYEHLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDF 187

  Fly   129 ADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYV 193
            :....||..||.::..:|.|.:.:::  .||..|...::||..:|:|.|:.:||...|....|.|
Zfish   188 SKPEIAAAEINKFIARKTHDKITNMV--KDLDADTVMMLINYMYFRGKWEKQFDAKLTHKADFKV 250

  Fly   194 SKSYQVNVNMMSQVGRFKMRTSTIDQIIELPFAY-SNLSMVIVLPKDNGSLTQAEATI------E 251
            .:...|.|:||.:.||:.:....::|...|...| .|.||:||||.| |.:.:.|.:|      .
Zfish   251 DQDTTVQVDMMKRTGRYDIYQDPVNQTTVLMVPYKGNTSMLIVLPND-GKMKELEESICRHHLKN 314

  Fly   252 SYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAF 316
            .:.::..:.:|:.  :|||.|....:|.:.|..||:.|.|:..:|.|.:..:...|:|:|:|:|.
Zfish   315 WHDKLFRSSVDLF--MPKFSISATSKLDDILMDMGMTDAFDYKADFSGMTEEVKVRVSRVLHQAV 377

  Fly   317 IEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDD--NIYFRGRVVDP 372
            :.:||:|..|.:.:...|..:|...|.:    :|.||:.:|.:|.  :|.|.|::.:|
Zfish   378 MSVDEKGTEAAAITTIEIMPMSLPHTVI----LNRPFLVLIVEDSTMSILFMGKITNP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 98/367 (27%)
serpina1lNP_001013277.3 alpha-1-antitrypsin_like 69..428 CDD:239011 98/372 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.