DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina1f

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:369 Identity:78/369 - (21%)
Similarity:172/369 - (46%) Gaps:30/369 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL-----NLPEDKKNVATIYDKL 80
            |::...|.:...||:.||:.|...:||:.:||.||.:..:...|     .|||  ..:...:..|
  Rat    55 LFKEMAQLSVNGNILFSPIRVIAAISMLSLGAKGNESKRILEILRLNKTGLPE--AEIHKCFRYL 117

  Fly    81 LTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQ 145
            |..:.:.::::.|...:.:|:::.:....::.:.|...:.::..:|...|..:|...||::::.:
  Rat   118 LRAIHQPEQLSPLKSGSGVFIHQDLTPVDKFVEGVKNLYHSDIVSINFTDCRRAKTQINNYMMTK 182

  Fly   146 TLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNM-----MS 205
            :...:|:|:  .:|..|....::|...:.....:.|...:.|.|.:::.:...:.|.|     ::
  Rat   183 SNKEIKNIV--KNLENDTYMAVVNYIIWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIVDLN 245

  Fly   206 QVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLTEMD-----VHV 265
            .:.|.:..:||   ::......||.:...::| |.|.:.:.|..: :||........     |::
  Rat   246 HLFRVEDLSST---VLVFTLLASNFTTYFIIP-DIGQMQKVEQRL-TYPHFRRMRRQSNLRMVNL 305

  Fly   266 QLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSAS 330
            :.|:..:....::...:..:||..:||:.::.|.::|.:..:..::|.|..:.||::|...|.::
  Rat   306 ETPELSLSETHDVESMMNLLGITYVFNNDANSSAVMNDTLQKSFKMVSKVKLTIDDKGSKPGRST 370

  Fly   331 ASPIRGLSDYATSVVTFTVNSPFVFMIRD--DDNIYFRGRVVDP 372
            .....|..|  ...|.|  |.||:..|:|  :|...|.||||:|
  Rat   371 CFKNDGSVD--VGYVQF--NRPFLIFIKDPTNDVPLFLGRVVNP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 74/364 (20%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 77/367 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.