DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and RGD1564786

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:411 Identity:118/411 - (28%)
Similarity:199/411 - (48%) Gaps:60/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLCWILVTTSVL----------GQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTA 57
            ::.:|::..|.|          |.|..:|::...:|..: |:..|...:...:|||||||:|.||
  Rat    29 FMMFIVILHSRLTIMDPLLKANGNFAIKLFKVLGEDISK-NVFFSLPSISSALSMILMGANGTTA 92

  Fly    58 NELRTALNLPEDKKN------VATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVN 116
            :::..|::|  ||.|      |...:..||||:.:.....:|..||.:|:.::..:...:....:
  Rat    93 SQICQAMSL--DKCNSIGGGDVHQHFLSLLTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACH 155

  Fly   117 KHFRAEAEAI--KLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKT 179
            |.:.||.|.:  |.|.. ::...||.||..:|.|.:::::.|..:..:....::|..:|||..:.
  Rat   156 KLYEAEIEELDFKGAPE-QSRQHINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEK 219

  Fly   180 RFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMR----TSTIDQIIELPFAYSNLSMVIVLP--- 237
            .|:|.:|:...|.||.:.:..|.||||...|||.    .||  |::.|||..|.|||...:|   
  Rat   220 PFNKADTREMPFKVSMNEKKTVQMMSQKSTFKMTYVKDIST--QVLTLPFENSILSMYFFVPDSH 282

  Fly   238 ----KDNGSLTQAEATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLF-NSSSDI 297
                |....||. :..:|...:..:.|.::.|.||:.|::...::...|:.:|:.|.| ...:|.
  Rat   283 VAQRKLENELTY-DKFLEWTDEDTMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADF 346

  Fly   298 SVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVT---------FTVNSPF 353
            |.:.::.|..:|:||||:|:|:.|||..|    |:|        |.|||         ...:.||
  Rat   347 SGISSKHGLFLSKVVHKSFVEMSEEGTEA----AAP--------TDVVTMKSPLTPRCLIADHPF 399

  Fly   354 VFMIRD--DDNIYFRGRVVDP 372
            :|.|:|  ...|.|.||...|
  Rat   400 LFSIQDTRSKEILFLGRFSSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 112/383 (29%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 114/392 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.