DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPIND1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:382 Identity:106/382 - (27%)
Similarity:183/382 - (47%) Gaps:42/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQD--NKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPE-----DKKNV 73
            :|...||| .|:|  |...||..:|:.:...|.||.:|..|.|..::.:.|:..:     .|..:
Human   132 KFAFNLYR-VLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEI 195

  Fly    74 ATIYD---KLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAA 135
            .||::   ||..:|.|......|...|.|::.:...:...:...|.:::.|||:   :||....|
Human   196 TTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQ---IADFSDPA 257

  Fly   136 W--AINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQ 198
            :  ..|:.::..|...:||.:  .::.|....:::|..:|||.|..:|....|....|.:::...
Human   258 FISKTNNHIMKLTKGLIKDAL--ENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREV 320

  Fly   199 VNVNMMSQVGRFKMRTSTIDQ-----IIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV- 257
            |.|:||...|.|   .:..||     |::|.:. ..:||:||:|.....:...||.:.  |::| 
Human   321 VKVSMMQTKGNF---LAANDQELDCDILQLEYV-GGISMLIVVPHKMSGMKTLEAQLT--PRVVE 379

  Fly   258 -----LTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFI 317
                 :|.....|.|||||::....|||:||.|||:.||:.:.:::.:.:|. ..|....|:..|
Human   380 RWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGISDQR-IAIDLFKHQGTI 443

  Fly   318 EIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDP 372
            .::|||..|.:.:......||    :.|.|||:.||:|:|.:...  :.|.|||.:|
Human   444 TVNEEGTQATTVTTVGFMPLS----TQVRFTVDRPFLFLIYEHRTSCLLFMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 103/377 (27%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 106/382 (28%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.