DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinc1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:385 Identity:117/385 - (30%)
Similarity:192/385 - (49%) Gaps:40/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNK--QYNIIASPLCVEIGMSMILMGADGNTANELRTALNL----PEDKKNVA 74
            :|....|: .|.|:|  ..||..|||.:....:|..:||..||..:|......    .:....:.
  Rat    90 RFATNFYQ-HLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKFDTISEKTSDQIH 153

  Fly    75 TIYDKLLTKLER-GKKVAILHLANRLFVNETIGVNKRYN---------KLVNKHFRAEAEAIKLA 129
            ..:.||..:|.| ..|.:.|..|||||.::::..|:.|.         ||....|:...|..:: 
  Rat   154 FFFAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQSRV- 217

  Fly   130 DRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVS 194
                   .||:||.::|...:||:|....:....:.|::|..:|||.||::|...||:.:.|:..
  Rat   218 -------TINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGLWKSKFSPENTRKEPFHKV 275

  Fly   195 KSYQVNVNMMSQVGRFK-MRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV- 257
            ......|.||.|.|:|| .|.....|::|:||...:::||::|||...||.:.|.  |..|::: 
  Rat   276 DGQSCLVPMMYQEGKFKYRRVGEGTQVLEMPFKGDDITMVLILPKPEKSLAKVEQ--ELTPELLQ 338

  Fly   258 -----LTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLL--NQSGTRISQVVHK 314
                 |:|:.:.|.:|:|:|:....|.|.|:.||:.|||: ..|.:..::  .:....:|...||
  Rat   339 EWLDELSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDDLFVSDAFHK 403

  Fly   315 AFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            ||:|::|||..|.::::..|.|.| ...|.|||..|.||:.:||:.  :.|.|.|||.:|
  Rat   404 AFLEVNEEGSEAAASTSVVITGRS-LNPSRVTFKANRPFLVLIREVALNTIIFMGRVSNP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 114/380 (30%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 114/380 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.