DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb13

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:393 Identity:116/393 - (29%)
Similarity:187/393 - (47%) Gaps:41/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL---------N 65
            ||..|....|:|.::     ...|:..|||.:...:.|||:|..|.||:||:..|         .
  Rat     8 TTHFLFDLFKELNKT-----SDGNVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTGSSR 67

  Fly    66 LPEDKKNVATI------YDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAE 124
            |..::|.:...      :.||||::.:..|...|.::|||:...|....::|...|.|::.|..|
  Rat    68 LKSEEKEIEKTEEIHHQFQKLLTEISKPTKDYDLIISNRLYGERTYLFLQKYIDYVEKYYHASLE 132

  Fly   125 AIKLADRLKAA----WAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMN 185
            .:   |.:.||    ..||.||..||.:.|||:.....|......|:||..:|||.|...|.|.:
  Rat   133 PV---DFVNAADESRKKINSWVESQTNEKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEH 194

  Fly   186 TKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTID---QIIELPFAYSNLSMVIVLPKDNGSLTQ-- 245
            ||.:.|:::|:....|.||:|...|.. |...|   :|:.:|:..|:.||.::||.|...|.:  
  Rat   195 TKEEDFWLNKNISKPVQMMAQCSSFSF-TLLEDLQAKIVGIPYKNSDFSMFVLLPNDIDGLEKII 258

  Fly   246 ----AEATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGT 306
                .|..:|......|.:..|.::||:.|::...:|..||:::||...|:..:|.|.:...||.
  Rat   259 DKLSPEKLVEWTSPGQLKQRKVDLRLPRLKVEETYDLQPTLEAVGIHSAFSEHADYSGMSAHSGL 323

  Fly   307 RISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRV 369
            :....:|::|:.:.|||..|.:.:....:.||  |.|......|.||:|.:  |:.|:|.|.||.
  Rat   324 QTQNFLHRSFLVVTEEGVEATAGTGVGFKVLS--AASCELVHCNHPFLFFVRHRESDSILFFGRF 386

  Fly   370 VDP 372
            ..|
  Rat   387 SSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 111/382 (29%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 115/391 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.