DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and serpinh1b

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio


Alignment Length:398 Identity:99/398 - (24%)
Similarity:191/398 - (47%) Gaps:39/398 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCWILVTTSVLGQFTK-----------------QLYRSFLQDNKQYNIIASPLCVEIGMSMILMG 51
            ||  |:..:|.|:..|                 .||.:..::....||:.||:.|...:.|:.||
Zfish     9 LC--LLAVAVSGEDKKLSTHATSMADTSANLAFNLYHNVAKEKGLENILISPVVVASSLGMVAMG 71

  Fly    52 ADGNTANELRTALNLPEDK-KNVATIYDKLLTKL-ERGKKVAILHLANRLFVNETIGVNKRYNKL 114
            :..:||:::::.|.....| :::.|...:|||:: :...:.....::|||:...::...:.:.|.
Zfish    72 SKSSTASQVKSVLKADALKDEHLHTGLSELLTEVSDPQTRNVTWKISNRLYGPSSVSFAEDFVKN 136

  Fly   115 VNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKT 179
            ..||:..|...|...|:..|..:||:|....|...:.:  |..|:...:.|:::||.|||.:|..
Zfish   137 SKKHYNYEHSKINFRDKRSAINSINEWAAKTTDGKLPE--ITKDVKNTDGAMIVNAMFFKPHWDE 199

  Fly   180 RFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQ--IIELPFAYSNLSMVIVLPKDNGS 242
            :|.......:.|.|::|:.|:|.||.:.|.:.....|.::  |:.:|.|:...||:.::|.....
Zfish   200 KFHHKMVDNRGFLVTRSHTVSVPMMHRTGIYGFYEDTENRFLIVSMPLAHKKSSMIFIMPYHVEP 264

  Fly   243 LTQAEATIESYPQI-----VLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLL 301
            |.:.| .:.:..|:     .|.|..|.:.|||..::...:|.:.|..:|:.:..: |.:|:|.:.
Zfish   265 LDRLE-NLLTRQQLDTWISKLEERAVAISLPKVSMEVSHDLQKHLGELGLTEAVDKSKADLSNIS 328

  Fly   302 NQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIY 364
            .:....:|.|.|.:.:|.|.||.....:    |.| |:...:...|..:.||:|:::|:  ::|.
Zfish   329 GKKDLYLSNVFHASSLEWDTEGNPFDPS----IFG-SEKMRNPKLFYADHPFIFLVKDNKTNSIL 388

  Fly   365 FRGRVVDP 372
            |.||:|.|
Zfish   389 FIGRLVRP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 91/381 (24%)
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 90/372 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.