DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina3m

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:393 Identity:105/393 - (26%)
Similarity:186/393 - (47%) Gaps:47/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPED- 69
            |...|:...|...||:.....|...|::.|||.:...::::.:||.|||..|:...|  ||.|. 
  Rat    45 LTLESINTDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESY 109

  Fly    70 KKNVATIYDKLLTKLER-GKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEA-----EAIKL 128
            :.::...:..||.:|.: |.:|.|: ..|.||:::.:.|...:.:.....::.||     :..::
  Rat   110 ETDIHQGFGHLLQRLSQPGDQVKII-TGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRV 173

  Fly   129 ADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYV 193
            .::|     |||:|.:||...:::::  |.|....|.|::|...|:|.||..||...|....|||
  Rat   174 TEKL-----INDYVRNQTQGKIQELV--SGLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYV 231

  Fly   194 SKSYQVNVNMMSQVGRFKMRTSTID---------QIIELPFAYSNLSMVIVLPKDNGSLTQAEAT 249
            .:...|.|:||      |:...|..         .::||.:. .|.|.:.:|| |.|.:.|.||:
  Rat   232 DEKRSVKVSMM------KIEELTTPYFRDEELSCSVLELKYT-GNSSALFILP-DKGRMQQVEAS 288

  Fly   250 IESYPQIVLTEMDV-------HVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTR 307
            ::  |:.:....|.       .:.||:..|.....|.|.|..:||:|:|:..:|:|.:.......
  Rat   289 LQ--PETLKKWKDSLRPRKIDELYLPRLSISTDYSLEEVLPELGIRDVFSQQADLSRITGAKDLS 351

  Fly   308 ISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVV 370
            :||||||..::::|.|..|.:|:.:.:...|.....:|.|  |.||:..:  .....|.|..:|:
  Rat   352 VSQVVHKVVLDVNETGTEAAAATGANLVPRSGRPPMIVWF--NRPFLIAVSHTHGQTILFMAKVI 414

  Fly   371 DPL 373
            :|:
  Rat   415 NPV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 101/379 (27%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 101/379 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.