DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina9

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:382 Identity:101/382 - (26%)
Similarity:180/382 - (47%) Gaps:39/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATI---- 76
            :|...||:...|.:...||:.||:.:...::|:.:||...|..::..:|..     |:..|    
  Rat    51 KFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGF-----NITHIAEHT 110

  Fly    77 ----YDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWA 137
                :::|:..|....|...|.:.:.||:.:.:.:..::...|.|.:..:..:...::.:.|...
  Rat   111 IHLGFEQLVHSLNECHKDLELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQAQ 175

  Fly   138 INDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNT-KPKVFYVSKSYQVNV 201
            ||.:|..:|...|.|:|  .||....:.|::|..|||..|...|...|| |...|.:||...|:|
  Rat   176 INSYVERETKGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTVHV 238

  Fly   202 NMMSQVGRFKMRTSTIDQ-----IIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV---- 257
            .||.|...|..   .:|:     |:::.:....::. .||| ..|.:.|.|.::.  |:.:    
  Rat   239 PMMHQTESFAF---GVDRELGCSILQMDYRGDAVAF-FVLP-GKGKMRQLERSLS--PRRLRRWS 296

  Fly   258 --LTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEID 320
              |.:..:.|.:|||.|.....|...|..|||:|.|||::|.|.:......::|:..|||.:::.
  Rat   297 RSLQKRWIKVFIPKFSISASYNLETILPEMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLDVS 361

  Fly   321 EEGGSAGSASASPIRGLS-DYATSVVTFTVNSPFVFMIRD--DDNIYFRGRVVDPLK 374
            |||..|.:|:.:.:...| |..:|.:.|  |.||:.::.|  .::|.|.|:|.:|.|
  Rat   362 EEGTEAAAATTTKLIVRSRDTPSSTIAF--NEPFLILLLDKNTESILFLGKVENPRK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 98/375 (26%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 101/382 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.