DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serping1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:387 Identity:88/387 - (22%)
Similarity:176/387 - (45%) Gaps:57/387 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVLGQFTKQLYRSFLQDNK-QYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVA 74
            :..|..|:.:||.:|....| :.|:..||..:...::.:|:||..:|.:.|...|:.|:|   .|
  Rat   148 SEALTDFSVKLYHAFSATKKAETNMAFSPFSIASLLTQVLLGAGDSTKSNLEDILSYPKD---FA 209

  Fly    75 TIYDKLLTKLERG--KKVAILH---LANR-LFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLK 133
            .::..|.....:|  ....|.|   ||.| .:||.::.:.....:::.....|.   :||     
  Rat   210 CVHQTLKAFSSKGVTSVSQIFHSPDLAIRDTYVNASLSLYGSSPRVLGPDGDAN---LKL----- 266

  Fly   134 AAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQ 198
                ||.||.:.|...:.:::  ..|..|...|::||.:....||..|::........|  |:..
  Rat   267 ----INTWVAENTNHKINELL--DSLPSDTRLVLLNAVYLSAKWKKTFEQKKMMASFLY--KNSM 323

  Fly   199 VNVNMMSQ----VGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKD-NGSLTQAEATIESYPQI-- 256
            :.|.|:|.    :..|..:|... ::.:|..:: |||.||::|:. ...|...|..:.  |.:  
  Rat   324 IKVPMLSSKKYPLALFNDQTLKA-KVGQLQLSH-NLSFVIMVPQSPTHQLEDMEKALN--PTVFK 384

  Fly   257 -VLTEMDV------HVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISV--LLNQSGTRISQVV 312
             :|.::::      :|.:|:.|:....:::..::.:   :.|:.:.|:::  |......::|.:.
  Rat   385 AILKKLELSKFQPTYVMMPRIKVKSSQDMLSIMEKL---EFFDFTYDLNLCGLTEDPDLQVSSMK 446

  Fly   313 HKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDNIY--FRGRVVDP 372
            |:..:|:.|.|..|.:||...:      |.:::.|.|..||:|::.|..:.:  |.|||.||
  Rat   447 HETVLELTETGVEAAAASTISV------ARNLLIFEVQQPFLFLLWDQRHKFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 83/377 (22%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 84/380 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.